PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_128244g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 401aa    MW: 44976.1 Da    PI: 7.1115
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_128244g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.71e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++lv+++++ G g+W++ ++  g+ R++k+c++rw +yl
   MA_128244g0010 14 KGPWTSEEDKILVNYIQENGHGSWRALPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding49.41.1e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+  ++++++ lG++ W+ Ia+ +  gRt++++k++w+++l
   MA_128244g0010  67 RGSFTQEEERTIIQLHAILGNR-WSVIASQLL-GRTDNEIKNFWNTHL 112
                      89********************.********9.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-23564IPR009057Homeodomain-like
PROSITE profilePS5129414.616961IPR017930Myb domain
SuperFamilySSF466895.75E-2911108IPR009057Homeodomain-like
SMARTSM007178.6E-131363IPR001005SANT/Myb domain
PfamPF002493.9E-151461IPR001005SANT/Myb domain
CDDcd001671.68E-91661No hitNo description
PROSITE profilePS5129424.55662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2565116IPR009057Homeodomain-like
SMARTSM007172.3E-1666114IPR001005SANT/Myb domain
PfamPF002491.7E-1467112IPR001005SANT/Myb domain
CDDcd001672.51E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MGRAPCCEKT GLKKGPWTSE EDKILVNYIQ ENGHGSWRAL PKLAGLLRCG KSCRLRWTNY  60
LKPDIKRGSF TQEEERTIIQ LHAILGNRWS VIASQLLGRT DNEIKNFWNT HLKKRLLRMG  120
IDPSTHAPRT DANPSSPQAF KALNLTRHKA QWENARLEAE VRLSRESLFM SSNSAAGYRT  180
NNTVELITMP DDNAPTDYFL KIWSSEAGKA FRKESSCRII NKSCNNSCHV FDLNHQNGGQ  240
DDQLLSSDTP KTPISSSLVS SLYCVSTQQC CYRSLNPDDT DKDNDSQHCN SASAEWIGDS  300
SVKTPDVLSC FADMTMGQTE RKVHKDSSSS EELGPAHVHC TGFSDLVQDF PDNNNSIGCM  360
IPELSTSFRQ QSTWPWSELN LEDSKDHWNN VSVTTRASAH G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051856.15e-94Myb domain protein 17 isoform 1
RefseqXP_011091956.13e-94PREDICTED: myb-related protein Zm38-like
TrEMBLA0A0K9PNG54e-94A0A0K9PNG5_Z
STRINGVIT_15s0046g03190.t016e-91(Vitis vinifera)
STRINGfgenesh1_pm.C_scaffold_50021025e-91(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.18e-94myb domain protein 17